Breaking news carlisle pa police. 12 fire trucks responded to a fire around 7:30 p.
Breaking news carlisle pa police At a Wednesday morning news conference, District Attorney Sean M. However, authorities were able to locate him nearby shortly after the Emergency crews are battling a residential fire that broke out in Carlisle on Tuesday night. (WHTM) — The motorcyclist who was killed in a deadly crash in Cumberland County Friday afternoon has been identified. According to the Camp Hill Police Department Carlisle Police announced Thursday they have found London Price, 13, and that she is safe. — Police in Cumberland County are looking for help identifying a retail theft suspect. , Carlisle Borough police were dispatched to the 300 block of C Street in Carlisle Borough for a disturbance. Cases; Arrests; Warrants; Most Wanted; Incident Blotter; the Lower Allen Township Police Department's warrant for Nashon Matai was served. FOX43 will provide updates as they become available. WNEP. Warrant Details Warrant Type : Criminal Date Issued : Thursday CUMBERLAND COUNTY, Pa. An employee inside the diner was injured during the collision and According to State Police in Carlisle, the 31-year-old male driver of the 2021 Toyota Tacoma crashed, causing a closure of the I-81N on-ramp to PA 465 after [] CARLISLE, Pa. Female undercovers posed as sex workers and posted advertisements police say they caught up with him after he left that scene, and say that he ignored commands to drop the machete and instead ran toward tree service workers who were in the road. 13. Operation Spotlight: Road safety op targets the Fatal Four-331 minute ago. A former Breaking News. In total, 1,854 stories have been published about Carlisle, England which Ground News has aggregated in the past 3 months. Police appeal for witnesses following The fire broke out just before 5:45 p. Cumbria police in Carlisle arrested a 16-year-old boy from Penrith on suspicion of breach of a dispersal order; an 18-year-old from Breaking News. Police said they found a homeless woman caring for the dogs whe To follow Carlisle Police Department, click the button below. He is in his 20s or 30s and was seen riding a bike with a CARLISLE, Pa. (WHTM) – One person was arrested after a police chase and crash in Carlisle. PSP said CARLISLE, Pa. View criminal charges, arrest reports and most wanted lists from PennLive. Carlisle Police have obtained an arrest warrant for Jarret Mercer concerning a PFA Breaking News. All residents of the building and adjacent properties were safely evacuated. According to Carlisle Police, detectives are investigating a shooting that occurred along th WHP CBS 21 Harrisburg provides local news, weather, sports, community events and items of interest for Harrisburg Lancaster Lebanon York and nearby towns and Breaking News. According to the Carlisle Police Department, a residence CUMBERLAND COUNTY, Pa. Police are investigating a suspected arson in the toy department of the Carlisle Walmart on Wednesday night. Latest news, weather & sports headlines serving Harrisburg, York, Lancaster and Lebanon, Pennsylvania. — Pennsylvania State Police have identified the suspect who allegedly robbed the Belco Community Credit Union on Carlisle Road Wednesday around 10:30 a. The Great North Air Ambulance Service said its critical care team was sent after it "received CARLISLE, Pa. 12 fire trucks responded to a fire around 7:30 p. – Police say a Carlisle man pistol whipped the victim in a weekend robbery. (WHTM) – Former Carlisle Police Department detective Christopher Collare was sentenced to 75 months in prison after a federal investigation found he used his position to obtain A Carlisle man, Jonathan Pike, 34, has been charged with one count of aggravated assault, terroristic threats, resisting arrest, and possession of marijuana following a confrontation with local police. Police in Carlisle are currently looking into a hit-and-run crash that ended up striking one person. (WHTM) — Police in Cumberland County are investigating an armed robbery at a convenience store that was caught on camera. Follow Carlisle Police Department. According to the Carlisle Police Department, crews responded to the 300 block of N CARLISLE, Pa. According to police, the incident occurred in the HARRISBURG, Pa. — A man is dead and two others are recovering after two shootings Tuesday afternoon in Uniontown. Pennsylvania State Police's Troop H Major Case Team was also activated and a death investigation is ongoing. North Middleton Township Police say it happened at 5:27 CARLISLE, Pa. (WHTM) — The search for a missing kayaker on a creek separating Cumberland and York counties has been called off until Sunday morning. — Carlisle police have issued According to a the Carlisle Police Department, Jarrek Anderson, 18, a wanted person, was located in a vehicle in a parking lot in the 500 block of S. Find photos and videos, comment on the news, and join the forum discussions at PennLive. Stephen Latshaw who took over as Breaking News. Police said that the crash occurred in the area of the 40 Suspect in custody following deadly New Castle shooting 00:39. The fire department says they responded to the Residences at Seven CARLISLE, Pa. NORTH MIDDLETON TOWNSHIP, Pa. We would like to show you a description here but the site won’t allow us. (WHTM) — An employee at the Sunnyside Family Restaurant in Carlisle was hospitalized after a car crashed through the restaurant’s wall and into the kitchen. (WHTM) – Carlisle Police say two people who did not arrive at a relative’s home after leaving the area have been found safe. (WHTM)– The gunman in the Cumberland County shooting shot his firearm at least 13 times in the direction of four other people, the charging documents state. Shippensburg Police Department (717-532-7361) Troopers with the Carlisle Station say they responded to Penn State Holy Spirit Hospital in East Pennsboro Township, Cumberland County on Oct. Carlisle Police were called to the 100 block of East Louther Street around 8:30 p. (WHP) — Firefighters responded to a rowhome fire in Carlisle Borough Tuesday night. Former York County mayor officiates 5,000 wedding. The incident occurred on January 1, 2025, around 5:17 PM in the 500 block of S. 327 B Street Carlisle, PA 17013 Breaking News Subscribe. — The man accused of shooting his alleged “ex-girlfriend” is behind bars, and police say the girl was only 16 years old and wasn’t the alleged target. (WHTM) – The subject of a warrant who shot an officer in Cumberland County who died has been identified by Pennsylvania State Police. Organizers called the event CARLISLE, Pa. (WHTM) — Police on the West Shore are investigating a report of shots fired Saturday evening. According to a police report, Shawn Harrison of C Breaking News. Anyone with information is advised to contact the Carlisle Police Department at 717-243-5252 or submit a tip online. (WHTM) — Police are investigating a burglary involving three male suspects that occurred at The Frog, Switch & Manufacturing Company on Oct. The Carlisle Fire Department says they were We provide you with the latest breaking news and videos straight from Franklin County PA. (WHTM) — Interstate 81 Southbound on the West Shore was closed last night due to a fatal rollover crash in Cumberland County. Mar 28, 2025. News / 6 hours ago. North Middleton Township police said they were called shortly before 8 a. Police were in CARLISLE, Pa. com is the official website for WNEP-TV, your trusted source for breaking news, weather and sports serving Northeastern and Central Pennsylvania CARLISLE, Pa. Carlisle Police say on the morning of October 21, officers were dispatched to a parking lot along th A portion of East High Street is closed as of 8 a. Santiago Gutierrez, 29, of Carlisle, is wanted on murder and firearm charges from Police said a home in the area was struck by gunfire during the incident. Carlisle Borough Police said they were Breaking News. (WHTM) – Carlisle Police are providing gifts for 141 children this holiday season. Upon arrival, Police were in contact with Wesley Newhouse, who had an active warrant for his arrest. gov. Fairview Township police were called to the southern end of the trailer park along Shauffnertown Roa Get the latest news, entertainment, and top stories about Carlisle from the BBC Stay current with all the latest and breaking news about Carlisle, England, compare headlines and perspectives between news sources on stories happening today. ly/PSP-SM. — The Carlisle Police Department is investigating a shots-fired incident at a home in Carlisle. Here you'll find the latest news, updates, and information for Cumbria, including about the Lake District, Carlisle, Barrow, Kendal, Workington and Whitehaven. According to the Carlisle Police Department, office Crews responded to a structure fire in Carlisle on Christmas Eve night, according to the Carlisle Police Department. Freddy Simon-Castro, whose address remains undisclosed, fled the scene before police arrived. Jamie Souders, 42, of On January 13, 2024, at 1:59 p. Get breaking news A masked burglar broke into a Penrith home in what police are describing as a high-value burglary. H According to a the Carlisle Police Department, Jarrek Anderson, 18, a wanted person, was located in a vehicle in a parking lot in the 500 block of S. Additional posts on social media from family Chambersburg Police say on September 16 around 11 p. Official PSP Facebook. 1. Carlisle Police identified the suspect as Jam Local News. , an unknown man entered the Family Dollar Store on East High Street in Carlisle Borough. Franky Burwell was apprehended by the Pennsylvania State Police in Perry County on Wednesday March 5th, 2025. (WHTM) — Police are looking for a man accused of doing sexual acts on himself during a movie inside a Cumberland County theater. The Cumberland County District Attorney’s office announced the arrests of HARRISBURG, Pa. (WHTM) — Police are clear of the scene of an incident which prompted a shelter-in-place for a Carlisle neighborhood. CARLISLE, Pa. (WHTM) — Police engaged in a shootout with a suspect wanted for murder in Harrisburg this morning near the PA Farm Show Complex. Get all the latest Harrisburg, Lancaster and York news, weather and sports from the WGAL News Team. The Commonwealth social media policy can viewed at bit. CUMBERLAND COUNTY, Pa. Ridge Streets. Hampden Township Police were dispatched for a disturbance at the 5000 Police in Cumberland County are investigating a shots-fired incident that happened late Thursday night. after a second-alarm fire call in the first block of North East Street in Carlisle. Pennsylvania mail-in ballots don't need accurate envelope dates, federal judge rules Get browser notifications for (WHTM) — The individual responsible for making threats via Snapchat toward multiple middle schools in the West Shore School District on Sept. (WHTM) — State Police are investigating the death of a 13-year-old child in Shippensburg on Tuesday. WHERE CREWS PUT OUT A HOUSE FIRE IN HAMPDEN TOWNSHIP IN CUMBERLAND COUNTY. Crime. Officers say they received a report of shots fired around 11:10 p. Get the latest news and headlines from KDKA-TV CBS2 Pittsburgh. According to Carlisle Police, the pictured suspect stole two six Taro D. (WHTM)– The Cumberland County District Attorney has made a ruling in a deadly Carlisle-officer-involved shooting in January. (WHTM)– A former employee for a Carlisle gas station, who reportedly used to also be a law enforcement officer, was charged for allegedly stealing thousands of dollars CUMBERLAND COUNTY, Pa. , according to Carlisle Police. — A three-story apartment building went up in flames Saturday evening in Cumberland County. , PPD detailed in the release. She was taken into custody Wednesday evening. officers were called to 132 Lincoln Way for a deceased 22-year-old man with a close-range gunshot wound in his upper back and other injuries Local, state, and federal government websites often end in . View daily weather and top stories from Philadelphia, Pittsburgh and beyond on pennlive. S. The 168th graduating class was held at S News, Events, Comments, and more from Gettysburg and Adams County PA On March 29, 2025, Middlesex Township Police responded to a hotel in the 1100 block of the Harrisburg Pike for unknown reasons. Angelo Rice WGAL News 8 is your source for the latest local headlines and live alerts. Uniontown police are leading the investigation into the initial, deadly shooting CARLISLE, Pa. com. Police have a person of interest. The incident occurred at 1501 Harrisburg Pike, according to police reports. — PA State Police (@PAStatePolice) November 8, 2024. According to fire CARLISLE, Pa. Welcome to the Camp Hill Police Department on the CRIMEWATCH Network. — Late Wednesday evening, police were called after shots were fired at the intersection of South Pitt Street and West Chapel Avenue. (WHTM)– Carlisle Police responded to reports of a male running around naked on West Ridge Street around 3:00 a. Listings of All incidents in Carlisle and the surrounding area. (WHTM)– A tractor-trailer caught fire on PA 581 in Cumberland County Tuesday morning, closing all eastbound lanes. Crews were called to North Pitt Str (WHTM) – The Pennsylvania State Police on Friday welcomed 74 new State Troopers following their graduation from the Pennsylvania State Police Academy. A place to share news and civil discussion! CARLISLE, Pa. Carlisle Police said in a report that a person was walking on a crosswalk between W. (AP) — Gunfire left a man dead and a police officer wounded as officers attempted to serve an arrest warrant in Pennsylvania, authorities said. On March 13 around 7:30 p. Previous article:On Jan. (WHTM) — A 16-year-old was injured during a shooting in Carlisle on Friday, Nov. Jonathan Pike, 34, was arrested after being spotted by officers in the 500 block of South CUMBERLAND COUNTY, Pa. According to a the Carlisle Police Department, Jarrek Anderson, 18, a wanted CARLISLE - Carlisle Borough police diverted traffic, and asked residents to stay indoors and keep their doors locked for about three hours Monday night due to a police incident in the area of On January 13, 2024, at 1:59 p. Kelley, 24, of Carlisle, was pronounced dead at the scene of the single-vehicle crash, which occurred at 12:21 a. at the intersection of CARLISLE, Pa. Any views or opinions expressed in this publication are of cumberland county, pa. Menu. (WHTM) — Police on the West Shore are seeking a man in connection with numerous catalytic converter thefts in 2023. A police incident that shut down multiple Cumberland County roads for hours on Monday has ended. (WHTM) — Carlisle Borough Police are currently investigating a “suspicious string of fires” that have occurred in the area. When Lt. Sorry Carlisle, PA (February 23, 2025) – Fire crews from multiple departments responded to a massive five-alarm apartment fire on Veterans Way in Carlisle on | Contact Police Accident Reports (888) 657-1460 for help if you were in this accident. (WHTM) — Troopers are looking for suspects in a theft were multiple chainsaws were stolen from a Franklin County Anyone with information on McKarchey’s whereabouts is asked to call the Carlisle Police at (717)243-5252 or call 911. publication. Jarred Tritt was wanted on domestic violence charges from an incident earlier in the day when officers located him and tried to take him into custody at about 9:45 p. (WHTM) — A State Police cruiser and a pickup truck collided on the outskirts of Carlisle, injuring the trooper and a passenger in the truck. Lower Allen Township Police issued an arrest warrant on Aug. AND WE BEGIN WITH BREAKING NEWS FROM OVERNIGHT. (WHTM) — Carlisle Police have arrested the suspect involved in a morning stabbing at the E. News Feed. The vehicle slammed into the side of Sunny Side Family Restaurant on North Hanover Street in Carlisle Borough around 8:50 a. on July 8. com for breaking news, videos, and the latest top stories in world news, business, politics, health and pop culture. Skip to content. According to Cumberland County District The fire was discovered by Carlisle Police who were patrolling in the area and saw a house on Lincoln Street on fire after 5:30 p. Pennsylvania’s largest municipal electric system, received national recognition for achieving EAST PENNSBORO TOWNSHIP, Pa. Bishop McDevitt's seven-run third inning propeled the team to a 10-3 win over Carlisle on Tuesday. ): According to the Carlisle Police, the outage is affecting a portion of the Borough of Carlisle, and traffic lights in the area. com and the Patriot-News. (WHTM) — State troopers are investigating after a juvenile was taken to a hospital with a gunshot wound. A preliminary hearing is scheduled for July 24. Pitt Street, Carlisle Borough. Sat, January 13th 2024 at 4:40 PM Pa. More Carlisle Police Department is searching for Destiny Ann McKarchey. on July 23. (WHTM) — Police in Cumberland County are investigating a hit-and-run crash that involved a struck pedestrian. (WHTM) — State Police say a former Sheriff’s Deputy in Cumberland County is charged with indecent assault of a 13-year-old boy. State Police in Carlisle announced the five most wanted in the area on ch We provide you with the latest breaking news and videos straight from Franklin County PA. No Breaking News. m. A group of protesters gathered in Carlisle Saturday night, demanding change. Lottery scratch-off ticket worth $1M sold in Pa. According to a Corporal with the Police said both the 55-year-old man and the 53-year-old woman who had been arrested had been injured. Borough police responded at abut 8:50 a. SECTIONS. gov" or "pa. Trystan Zimmerman, 25, and Sophia Brandt, 19, allegedly attempted to rob multiple Get Lehigh Valley news, Allentown news, Bethlehem news, Easton news, Quakertown news, Poconos news and Pennsylvania news from The Morning Call. In the News; Directory. (WHTM)– Police are investigating a hit-and-run crash of a pedestrian in Cumberland County. — Police were at the scene of an active incident in Carlisle on Monday night. 21. NEW CASTLE, Pa. Any views or opinions expressed in this publication are of the The Pennsylvania State Police is hosting an eight-week Citizen’s Police Academy in Carlisle. A boy has been arrested and bailed after a racially aggravated attack in Carlisle, which CARLISLE, Pa. Police have located a missing teen from Beavercreek. 3, according to a report from Pennsylvania State Police. Latest. Located in Camp Hill, PA, our goal is to reduce crime and enhance public safety. (WHTM) — A disaster declaration has been issued as 42,000 Cumberland County water customers are either under a boil water advisory or without water service altogether. (WHTM) — Crews were busy on Christmas Eve night battling a building fire in Carlisle. The report of the structure fire came in just before 8:30 p. Activating this element will cause content on the page to be CUMBERLAND COUNTY, Pa. Visit Pennsylvania Susquehanna Valley's most reliable source for breaking news. Police were called to the shooting in the 3200 block of D Street, in the 25th District, at 6:21 p. (WHTM) — A man is wanted for allegedly raping a Cumberland County hotel employee in February. (WHTM)– Police in Cumberland County are investigating after a residence was struck with gunfire late Monday night. From News and Star. Stay updated with the latest Carlisle, PA local news, trending, crime map, events, weather, traffic & transit, sports, lifestyle, education, municipal, business, food & drink, arts & culture, health, CARLISLE, Pa. Hospital Staff After DUI Arrest In Pennsylvania Coffee Break Bandits Rob Carlisle Motel 6 Stealing Cash And Coffee (Videos) Police & Fire Attempted Carlisle police announced on Friday, Jan. She is 5 feet 8 inches tall. gov" at the end of the address. Old York Road, state police said. According to Pennsylvania State Police, an active police incident on the 3400 The Pennsylvania State Police (PSP) Carlisle Criminal Investigation Unit along with members of the Cumberland County District Attorney’s Office, CID unit, conducted a sting operation targeting persons patronizing sex workers. Police said Camel struck the victim in the face, breaking the victim's eyeglasses. WORMLEYSBURG, Pa. Get Pennsylvania latest news. Saturday to the area BBC News, North East and Cumbria. The situation escalated, CUMBERLAND COUNTY, Pa. According to the Middlesex Township Police Department, the burglary occurred between noon on Jan. According to the Carlisle Police Department, on July 20 at about 9:16 a. Sorry Man arrested on warrant, resisting arrest charge LEWISTOWN — Coty Lee Breon, 35, address unknown, was held in the Mifflin County Correctional Facility in Lewistown for an active bench warrant and subsequently resisting PA State Police. — A Cumberland County man is facing multiple charges after police claim he broke into several homes and vehicles while inebriated. The 40-year-old was inside a home in Borland Avenue, Carlisle, when Cumbria Police were Since these operations began in June 2022, 60 individuals have been arrested. Stephen Latshaw had been the interim police chief in Carlisle since Stephen Margeson retired in March of last year. , Carlisle Borough Police were dispatched to a report of a shoo CARLISLE, Pa. The recent operation was conducted alongside the Hampden Township Police Department and the Cumberland County Sheriff ADAMS COUNTY, Pa. Video above: headlines from WGAL News 8Cumberland County dispatchers say the first calls came in Breaking Local News and Latest Headlines about coronavirus in Pennsylvania, weather and sports Carlisle News; Harrisburg News; — Pennsylvania State Police troopers will be trading in CUMBERLAND COUNTY, Pa. We'll bring you breaking news, police CARLISLE, Pa. The owner of the restaurant, Amy Anthony, said one of their employees CUMBERLAND COUNTY, Pa. — Police are investigating a suspected burglary in Cumberland County. On July 17 at 10:12 p. 18 at around 7:42 p. County Carlisle police said in a statement to CBS 21 News, "A male operator collided with the building, causing damage to the structure. According to Carlisle Police, on Saturday, Nov. , world, weather, entertainment, politics and health at CNN. Latshaw was the chief of police for over 20 years. FRANKLIN COUNTY, Pa. (WHTM)– A New Jersey woman is being charged for allegedly stabbing the driver of a vehicle, causing it to crash in Cumberland County on Dec. With a population of approximately 108,000, Carlisle serves as the administrative centre for both the City of Carlisle News; Harrisburg News; Lancaster News; Police investigating report of shots fired in Harrisburg Local Central Pennsylvania Breaking Local News and Latest Headlines (WHTM) — The Carlisle Police Department is asking the public for information in a shooting investigation from Thursday, November 9. State Police at Carlisle said in a news release that Troopers got a CUMBERLAND COUNTY, Pa. (WHTM) — A veteran detective for the Carlisle Police Department and Cumberland County Drug Task Force, was convicted by a federal jury on July 16 for bribery, drug distribution CARLISLE, Pa. (WHTM) — Police in Carlisle were on the scene of a crash that involved a train and a tractor-trailer on Monday morning. on March 31 at the Northside Village Apartments in Lower Frankford Township, near Carlisle. During the Find All incidents in Carlisle. 11. , State Police were di CUMBERLAND COUNTY, Pa. 7 for 28-year (WHTM) — After seeing declining rates for decades, police departments are warning residents of a serious uptick in vehicle thefts in the Midstate. News, sports and community news for the Borough of Carlisle. (WHTM) — Carlisle Police are investigating a reported stabbing incident that occurred earlier today. on the 300 block of North Hanover Street CARLISLE, Pa. According to Middlesex Township Police, the burglary occurred sometime between noon on CARLISLE, Pa. According to a press releas Pennsylvania State Police, Carlisle station, and Shippensburg University Police Department assisted the Shippensburg Police Department and the investigation is ongoing. Appeal for missing teen from Workington Appeal for missing 17-year-old from Carlisle-1598 minute ago. (WHTM) — The Carlisle Pike is back open in Adams County after a nearly 12-hour police incident. Taro Landis will join the department on March 1. Thursday. by CBS21 News. — Update: On Saturday, According to police, a fight broke out while officers were investigating the suspect, 33-year-old Nathaniel Law Liberator. — Police in Cumberland County are investigating a reported shots fired incident that happened on Saturday, Dec. (WHTM) — Police say they are searching for the gunman from a deadly Harrisburg weekend shooting. The West Shore Regional Police Department is Stay updated with the latest Chambersburg, PA local news, trending, crime map, events, weather, traffic & transit, sports, lifestyle, education, municipal, business, food & drink, arts & culture, health, local life, real estate, and more. (WHTM) — Police are investigating reports of shots fired in Carlisle. (WHTM) — The Cumberland County Sheriff’s Office is sought an inmate they say walked off from work release Wednesday. Crime and court news Man Located in Carlisle, PA, our goal is to reduce crime and enhance public safety. Police were called to North West Street at West Penn Street at 12:10 a. (WHTM) — Police in Cumberland County are investigating multiple vehicle thefts and break-ins along Rupley Road in Wormleysburg. Various topics will be covered throughout the course – ranging from traffic stops, to animal Man Killed, Infant Shot In PA, Police Say (Developing) A double shooting has left a 25-year-old man dead and a 1-year-old boy injured, Philadelphia police announced late on Wednesday night, Sept. This is a developing story. The crash happened around 8 p Allison Choice turned herself in to Forks Township Police on March 25, 2025, and was arraigned by Judge Hutnik, who set bail at $5,000 unsecured. Breaking News SIGN UP NOW. on Nov. Warrant Details Warrant Type : Arrest Date Issued : Thursday March 6th, 2025 Issuing Authority : MDJ 03-2-09 Holding Department : F A man from Joliet, Illinois, led police on a pursuit on the Pennsylvania Turnpike in Cumberland County on Aug. Bishop McDevitt scores 7 in the 3rd inning to beat Carlisle 10-3. 4 and 6 a. to a home in the 2500 Breaking News. Download the CRIMEWATCH app and follow Carlisle Police Department. 10, 2024. Landis was sworn in as Carlisle’s chief of police Wednesday evening. The E-edition is available to you every morning, and is updated throughout the day CARLISLE, Pa. WHTM-TV is your ABC television affiliate in all of Latest Carlisle news, with headlines covering crime, travel, weather, local plans and developments in the Cumbrian city. (KDKA) -- A suspect has been taken into custody following a homicide in New Castle, Lawrence County, over the weekend. Local News Keep up with updates on local crime, street gangs and police news in Central PA. Visit Albuquerque's most reliable source for breaking news. Carlisle, the largest city in Cumbria, is a historic settlement located on the River Eden in the north of England. Details are limited at this Police in Carlisle shot and killed a person on Saturday afternoon, prompting road closures in the area for several hours and a heavy response from Pennsylvania State Police. The collision was reported around 8:30 a. 6 for a juvenile man with a gunshot wound. (WHTM) – Carlisle Police are investigating a late night shooting that happened on Sunday. Christopher Diaz, 35, is wanted by Carlisle Police on 21 counts DAUPHIN COUNTY, Pa. According to State Police, the crash occurred Breaking News for Penrith, Cumbria, Carlisle, and The Lake District CUMBERLAND COUNTY, Pa. — UPDATE (11:00 a. — First responders in Cumberland County were at the scene of an "active police incident," according to Cumberland Goodwill EMS and Cumberland County 911 Dispatch. Several boats were deployed on the A man who was shot dead by police had made threats to kill while children were present, a watchdog has said. News 8 is learning more about the man CUMBERLAND COUNTY, Pa. State Police at Carlisle were called to Penn State Holy Stay updated with the latest Mechanicsburg, PA local news, trending, crime map, events, weather, traffic & transit, sports, lifestyle, education, municipal, business, food & drink, arts & culture, health, local life, real estate, and more. Mercer, Jarret M - Contempt for Violation of Order (PFA Violation) Warrant. (WHTM)– Carlisle Police rescued a litter of seven 2-week-old puppies and their mother after responding to a call. 8 August 2024. 24. — The Carlisle Police Department is investigating a reported shooting. (WHTM) — The discovery of child pornography on an employee’s iPad at a restaurant in Carlisle has led to more than 150 charges being filed, CARLISLE, Pa. (WHTM) — Police in Carlisle are actively investigating a shooting that occurred during the morning hours of Saturday, Aug. Landis replaces Lt. — Police have confirmed that Carlisle Springs Road will be closed due to a motor vehicle accident occurring on the 1300 block. (WHTM) — Calls for police reform and an end to racism continue locally. , Carlisle Police were abc27 is your local source for breaking news, the latest headlines, severe weather, sports, and traffic in Harrisburg, York, Lancaster, Lebanon. More CARLISLE, Pa. According to PennDOT, the incident occurred between t CARLISLE, Pa. around 9:45 p. The fire was reported around 9:40 p. More » Crime Pennsylvania State Police arrest duo accused of vandalism and burglary crime spree. on E. 9. Police say [] According to the Carlisle Police Department, on Thursday, March 4 at 10 p. According to the Carlisle Police Department, on December 21, 2024, at about 8:30 p. (WHTM) – Pennsylvania State Police have released new details into a Carlisle death investigation that began on Sunday evening. The situation escalated, resulting in an altercation between officers and a suspect. (WHTM) — One man is dead and another person is wounded after a shooting in Carlisle. Shots were fired into a home in the Meadowbrook Court trailer park in Fairview Township, police said in a release issued on Sunday, Dec. Amanda Marie Powered by Eyewitness News, WBRE/WYOU. According to the Carlisle Police Department, a residence CARLISLE, Pa. Traffic Mason A. According to Penn CARLISLE, Pa. (WHP) — UPDATE | State police confirmed that the victim was Officials say that calls first came in of a possible disturbance on the CARLISLE, Pa. (WHTM)-- Pennsylvania State Police engaged in a multi-county car chase which ended in a deadly shoot out after an Altoona man shot multiple people in an apartment building in The best source for breaking news, weather and in-depth investigations from Franklin County Free Press. Back ×. The fire occurred in the 300 block of North Hanover Street at 9:15 p. Pitt and W. McCormack said the person who was fatally shot, Nathaniel Liberator, was trying to stab a Carlisle police officer with a sharpened View the latest news and breaking news today for U. Pitt Street. High Street Speedway convenience store. The apartment CARLISLE, Pa. — Carlisle Borough Police are investigating a string of suspicious fires in the borough. Police said they were last seen in the area of CARLISLE, Pa. News & Star - first for news, sport, events in Carlisle, Penrith, Keswick, Workington, Whitehaven, the Lake District in north, east and west Cumbria. World. (WHTM) – Commissioner Robert Evanchick announced Friday that 99 cadets graduated from the State Police Academy in Hershey and have been assigned to troops across the commonwealth Next of kin has been notified. Published. (WHTM) – The Carlisle Fire Department says dozens of people were evacuated during Saturday’s apartment fire. news. , police said in a news release. (WHTM) — State Police have filed charges against two Cumberland County residents, one of which recently worked at a local childcare facility. Activating this element will cause content on the page to be updated. According to the Cumberland County Coroner, the CARLISLE, Pa. It occurred overnight on Monday, Nov. According to the Carlisle Police D CARLISLE, Pa. Latest News Stories. 13, just before 2 p. (WHTM)– A person is dead after an officer-involved shooting in Cumberland County on Thursday evening. Keep your pulse on the news CARLISLE, Pa. The Franklin County Free Press is a Neil Publishing, LLC . Warrant Details Warrant Type : Criminal Date Issued : Tuesday July 31st, 2018 Issuing Authority : MDJ Clement Holding Department : Lower Allen Township Police Dept Welcome to Cumbria Live. Latest news for north, east and west Cumbria from the News and Star in Carlisle. Go to NBCNews. (WHTM) — A civil suit filed in Cumberland County reveals a former police chief and director of public safety for Middlesex Township is under investigation for fraud. (WHP) — Carlisle police asked a community to stay inside their homes Monday while officers searched for a wanted suspect near S. NewsBreak provides real-time local updates to keep you informed about your community and nearby towns. 18 into Tuesday, Nov Carlisle Your Local News for Carlisle, Pennsylvania. Carlisle Police said an active police incident is According to the Carlisle Police Department, a residence in the 100 block of Liberty Avenue was struck with gunfire during a shots fired incident. Jarrek Carlisle police have issued an arrest warrant for a man they say was found with fentanyl. Commonwealth of Pennsylvania government websites and email systems use "pennsylvania. (WHTM)– The area of North 21 Street and Paige Street in Cumberland County was closed to vehicles and pedestrians Thursday after a vehicle crashed into a structure, caus news. More » Cumberland County CARLISLE, Pa. m UNIONTOWN, Pa. Breaking News. 323,993 likes · 20,435 talking about this. (WHP) — A pedestrian was hospitalized after they were struck by a vehicle in Carlisle Thursday morning. According to police, the activity was Chambersburg, PA Breaking Local News and Latest Headlines. April 01, 2025 at 12:53 pm EDT. (WHTM) — Pennsylvania State Police have released their most wanted list for Cumberland County. Close Ad. 4. Community Affairs Officer Trooper Kelly Smith joined abc27 News Good Day A man has been arrested following an incident where he allegedly pointed a gun at a driver on Sunday. Every year officers, department employees, and volunteers wrap gifts that were donated for kid CARLISLE, Pa. The Carlisle Fire Department says they were Pennsylvania State Police from the Carlisle barracks, a state police helicopter and Cumberland County Sheriff’s Office assisted at the scene of Monday’s manhunt. (WHTM)– Three Mechanicsburg juveniles led police on an 8-mile-long car chase through Cumberland County before crashing, according to Pennsylvania State Police. (WHTM) — Multiple fire crews were called to an overnight fire at a row home in Carlisle on Sunday night that sent one person to the hospital. A video submitted to abc27 depicts a white CUMBERLAND COUNTY, Pa. CUMBERLAND CO, Pa. (WHTM) — Officials in Cumberland County announced dozens of arrests in connection to a recent operation. Police say they received a report of shots fired just after CARLISLE, Pa. Carlisle police responded to the intersection of A Street and Factory Street just after 11 p. Stay in the know with the top stories of the day. * Breaking news updates – top banners let you know what’s happening right now * Follow author – get notifications whenever your favorite writers post a story If this is the Carlisle PA Sentinel newspaper, it is WAY HARRISBURG, Pa. — Carlisle residents may have noticed a large police presence along along East Louther Street and North East Street early Thursday morning. Have a breaking news tip? Beavercreek teen missing for over a week found safe . on Jan. 6 at a business located at 7365 Wertzville Road in Carlisle. (WHTM) – The Carlisle Police Department is welcoming a new chief of police. Before sharing sensitive or personal information, make sure you're on Pennsylvania State Police continue to investigate whether a Carlisle officer was justified in shooting and killing a man during an altercation on Saturday. According to the CUMBERLAND COUNTY, Pa. Daniel Bitner, 38, was found passed out in a vehicle in the middle of the 300 block of South West Get the latest Pennsylvania news, sports, and breaking updates. 10. m CUMBERLAND COUNTY, Pa. 11 has been identified by police, according to the KOAT Action 7 News is your source for the latest local headlines and live alerts. , Carlisle Borough Police responded to a disturbance call in the 300 block of C Street, Carlisle Borough, PA. goqseztcuazkynaynhyvstkdwmytfhnmyrhvmlsnioclzwltxnxdbmlkxuuupljnlgmchbpinkkjn